Vitamin D3 receptor, VDR, 1,25-dihydroxyvitamin D3 receptor, Nuclear receptor subfamily 1 group I member 1, VDR, NR1I1.
Vitamin D receptors (VDRs) belong to the NR1I family, which also includes pregnane X (PXR) and constitutive androstane (CAR) receptors which form heterodimers with members of the retinoid X receptor family. VDR is expressed in the intestine, thyroid and kidney and has an imperative role in calcium homeostasis. VDRs inhibit expression of 1alpha-hydroxylase (the proximal activator of 1,25(OH)2D3 and induce expression of the 1,25(OH)2D3 inactivating enzyme CYP24. Additionally, VDR has recently been recognized as an additional bile acid receptor alongside FXR and may function to protect gut against the toxic and carcinogenic effects of these endobiotics. Hereditary mutations in the VDR gene leads to rickets, which is typified by muscle weakness, growth retardation, bone deformity and secondary hyperparathyroidism. The human gene encoding the VDR is localized to chromosome 12q12-q14.
Vitamin D Receptor Human Recombinant produced in E.Coli is a full length protein consisting of 427 amino acids having a molecular weight of 48.3kDa and fused with 5.5kDa amino-terminal His-Flag tag.
VDR is purified by proprietary chromatographic techniques.
Escherichia Coli.
Sterile filtered colorless solution.
VDR protein is supplied in 50mM Tris, 150mM NaCl and 10% Glycerol, pH 7.5.
Store at 4°C if entire vial will be used within 2-4 weeks.
Store, frozen at -20°C for longer periods of time.
Please avoid freeze thaw cycles.
Greater than 70.0% as determined by SDS-PAGE.
MSYYHHHHHHDYDIPTTDYKDDDDKDYKDDDDKENLYF
QGEFMEAMAASTSLPDPGDFDRNVPRICGVCGDRATGF
HFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNR
RHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEE
EALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFR
PPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITS
SDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADL
VSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRS
NESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIK
FQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQD
RLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHS
KQYRCLSFQPECSMKLTPLVLEVFGNEIS.
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
